PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G48510.1
Common NameLOC102700944
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 261aa    MW: 29164.9 Da    PI: 8.6266
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G48510.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.22.6e-29959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krienk+ rqvtf+kRrng+lKKA+EL +LCdae+a+iifss+g+lye+s+
  OB01G48510.1  9 KRIENKTSRQVTFCKRRNGLLKKAYELAILCDAEIALIIFSSRGRLYEFSN 59
                  79***********************************************95 PP

2K-box111.11.2e-36841759100
         K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                    + + +++ qqe+ak++ +i++Lq+ +Rhl+Ge++++++ keL++Le++Lek++++iRskK+ell+++ie++qk+e +l++en+ Lr+k++e
  OB01G48510.1  84 IDVNSHQYFQQEAAKMRHQIQTLQNANRHLMGESIGNMTAKELKSLENRLEKGISRIRSKKHELLFAEIEYMQKREADLHNENMFLRAKVAE 175
                   566889***********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.347161IPR002100Transcription factor, MADS-box
SMARTSM004328.9E-41160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.5E-31275IPR002100Transcription factor, MADS-box
CDDcd002659.62E-45276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-31323IPR002100Transcription factor, MADS-box
PfamPF003194.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-2986173IPR002487Transcription factor, K-box
PROSITE profilePS5129715.16289179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MGRGKIEIKR IENKTSRQVT FCKRRNGLLK KAYELAILCD AEIALIIFSS RGRLYEFSNV  60
NSTRSTIERY KKASASTSGS APVIDVNSHQ YFQQEAAKMR HQIQTLQNAN RHLMGESIGN  120
MTAKELKSLE NRLEKGISRI RSKKHELLFA EIEYMQKREA DLHNENMFLR AKVAEAEQAH  180
EQQQEHAADQ DHDEMVAPAA GGGSSSGTEL EALPATLDTR EYYPPAPPVS MLAAAAAQYS  240
SDHQTALHLG YFKVDSGKGL L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-19164164Myocyte-specific enhancer factor 2B
1tqe_R2e-19164164Myocyte-specific enhancer factor 2B
1tqe_Q2e-19164164Myocyte-specific enhancer factor 2B
1tqe_P2e-19164164Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0709580.0AK070958.1 Oryza sativa Japonica Group cDNA clone:J023065L09, full insert sequence.
GenBankAY5519130.0AY551913.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS207 mRNA, complete cds.
GenBankFJ7509440.0FJ750944.1 Oryza sativa clone KCS020C02 MADS-box transcription factor 21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006645140.10.0PREDICTED: MADS-box transcription factor 21 isoform X2
SwissprotQ8RU311e-169MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLJ3L6J50.0J3L6J5_ORYBR; Uncharacterized protein
STRINGOB01G48510.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-87MIKC_MADS family protein